Lamzac Original Air Liege das stvoby2110-Stühle

550 Paracord 100 Ft – Pfau
Explorer Titanium Tisch 122x79x70cm Aluminium Alu Campingtisch Rolltisch Klapptisch Falttisch klappbar
Seite auswählen

D + A + Ost-Europa Karte Topo, 4 GB MicroSD-Karte für Garmin Geräte für Garmin Geräte Wander & Outdoor GPS-Geräte

Analyse und Kommentar: Der Kreistag wird größer, vielfältiger, jünger

Enzkreis. Die Wähler haben den Kreistag bei den Wahlen am Sonntag ganz schön verändert. Zu erwarten war das mit Blick auf die neuen Listen, die angetreten waren. ... mehr

Huifang grills QFFL dainkaolu Barbecue-Ofen-automatischer drehender Grill-elektrischer Grill-Grill-Eisen-Grill-Spieß-Haus-rauchfreier Grill
Dach V.19 - Outdoor Topo Karte kompatibel zu Garmin Farbeado 300, Farbeado 400c, Farbeado 400i, Farbeado 400t
The Uppercrust Dundee Deluxe Grün Tartan 4 Person behindern

Gleich mehrere Wahlen stehen am 26. Mai in Mühlacker und dem Enzkreis an: Gewählt wird etwa das Europäische Parlament, der Gemeinderat, der Kreistag und in manchen Gemeinden auch die Ortschaftsräte. Sobald die Ergebnisse verfügbar sind, werden diese an dieser Stelle durch die PZ veröffentlicht. ... mehr

Fitness Armband Sport Fitness Armband Running Fitness Armband Wasserdicht Fitness Armband Schwimmen Fitness Armband GPS Fitness Armband Schrittzähler Fitness Armband Pulsuhren Fitness Armband Blautooth Fitness Armband Handys Fitness Armband
LLRDIAN Outdoor Klappstuhl, tragbarer Regiestuhl, Skizze, Strandkorb, Angelstuhl Mini

Wahlergebnisse Remchingen: Ergebnisse der Gemeinderatswahl und Europawahl 2019

Gleich mehrere Wahlen stehen am 26. Mai in Remchingen und dem Enzkreis an: Gewählt wird etwa das Europäische Parlament, der Gemeinderat, der Kreistag und in manchen Gemeinden auch die Ortschaftsräte. Sobald die Ergebnisse verfügbar sind, werden diese an dieser Stelle durch die PZ veröffentlicht. ... mehr

Baden-Württemberg
Lorenlli Monokularteleskop Hohe Klarheit Große Blende Beobachtung Wasserdichte Grüne Film Teleskop HD Outdoor Spotting Zoom Scope

Nach der Wahlschlappe weicht der umstrittene CDU-Landeschef Thomas Strobl dem innerparteilichen Druck. Kultusministerin Eisenmann soll für die CDU bei der Landtagswahl 2021 ins Rennen gehen. ... mehr

Dlzaq Elektrischer Massagegerät für Männer, ABS + TPE Herrenschale Auto-Matic Saugen Vibrationsspielzeug
Icebreaker Damen Merino Merino Tech Lite Tank

Internationaler Beirat hat Nachfolger im Blick – alles zur Bewerbungsphase

Pforzheim. Zeitgleich mit dem Gemeinderat steht auch beim Internationalen Beirat der Wechsel an. In wenigen Wochen startet die Bewerbungsphase für die neuen sachkundigen Mitglieder. ... LQUIDE Herrentaschen Leder Lässige Multi-Funktion Schulter Diagonal Tasche Outdoor-Trage-Gürtel Telefon-Tasche Kann 6-Zoll-Handy-Gurt Verstellbar Installiert Werden

ZLY Intelligente Elektrische Zahnbürste, Erwachsene Induktion Lade Automatische Mundpflege Automatische Wasserdichte Modi
AMIGO Delfin Schulranzen-Set 8tlg. mit SCHULSPORTTASCHE, BROTDOSE, TRINKFLASCHE und HEFTBOX A5
ZYN Klappstuhl Recliners Beach Chair Angeln Portable Camping Outdoor Sessel

Pforzheim. Der Prozess scheint manchen Zuschauer auch am fünften Verhandlungstag noch zu belustigen, so wird das Plädoyer des Staatsanwalts Bernhard Ebinger an diesem Montag mit Zwischenrufen und Lachern kommentiert. ... mehr

Gearwear Läufer mit Gürtel für iPhone 7 x 8 6 Plus Mann Frau/leicht Telefon Workout Fitness Taille Band Gürtel Tasche für Walking/Radfahren, Reißverschluss Reisen Geld Gürtel

Polizei und Feuerwehr retten ältere Frau aus hilfloser Lage

Pforzheim. Ein Einsatz von Feuerwehr und Polizei hat am Montagabend für Aufsehen in der Pforzheimer Nordstadt gesorgt. Eine ältere Frau musste dabei aus ihrer Wohnung geholt werden. ... Campingtoilette mobil Reisetoilette Outdoor Toilette abnehmbarer Abwassertank 20 L

IFitness 2 verschließbaren Trinkflaschen Ersatz-Unisex Erwachsene
Anna Kletterstuhl Outdoor Klappstuhl Büro Mittagspause Haushalt Faul Sessel Portable Beach Lounge Chair Reise Wandern Stuhl Tragenden 150 kg
Strukturierter Tempera Mode Wilde Einfache Elegante Quadratische Tasche Einzelne Schulterbeutel Für Mann

Pforzheim. Die Erschließungsarbeiten im Lange Gewann - zweiter Bauabschnitt sind so weit fortgeschritten, dass voraussichtlich ab Montag, 27. Mai, mit den Vorbereitungsarbeiten in der Hercyniastraße begonnen werden kann. Der Durchgangsverkehr in der Hercyniastraße kann ab diesem Zeitpunkt bis zur Fertigstellung der Erschließungsarbeiten (voraussichtlich Ende März 2020) nicht mehr gewährleistet werden. ... Bewegliche Anti-Schleuder- und Geruchs-Beständige Bewegliche Toilette der Beweglichen Toiletten der Älteren Frauen der Kinder WC-Stuhltoilette,B

Verbandschrank Bonn Norm gefüllt DIN 13157
Outdoor Klappstuhl Büro Mittagessen Lounge Stuhl Angeln Stuhl Tragbare Camping Strand Stuhl Haushalt Stuhl
KAI LE Angelgerät Angelstuhl Klapp Angeln Stuhl Angelrute Angelstuhl Stuhl Set Angelausrüstung Angeln Stuhl

Nach tragischem Tod von Mutter und Sohn: Bestürzung bei Anwohnern in Tiefenbronn

Tiefenbronn. Große Bestürzung herrscht am Sonntag in Tiefenbronn: Einen Tag nach dem tragischen Tod einer Frau und ihrem achtjährigen Sohn sind Nachbarn und Gemeindemitglieder tief betroffen. Ein 60-jähriger Familienvater steht unter dringendem Tatverdacht, die beiden getötet zu haben. ... SamuroMüller Outdoor Klappstuhl Camping Portable Luftfahrt Aluminiumlegierung Angeln Stuhl Licht Mond Stuhl

Campart Kühlbox mit 41L Fassungsvermögen [geräuschearm, 230V-, 12V- und Gasbetrieb möglich], Innenraumfläche (27x43x37cm), CB-8676
SCHÖNEK Gummimatten Typ 03 f. Nissan 2TEILIG schwarz
SryWj Auto-Kühlschrank 30L Im Freien Mit Laufkatzen-Rad-großer Kapazitäts-elektronischem Heißem und Kaltem Kühlraum

Pforzheim/Ispringen. Gleich zwei betrunkene Autofahrer kontrollierte das Polizeirevier Pforzheim-Nord in der Nacht zum Samstag in Ispringen und Pforzheim. Beide hatten rund 1,5 Promille und diverse Ausfallerscheinungen gezeigt. ... Ultrasport GPS Reise Sportcomputer Navcom 400

Region

Schlagloch: Pedelec-Fahrer stürzt und verletzt sich schwer

Neuhausen. Ein 52-jähriger Pedelec-Fahrer ist am Sonntag bei einem Sturz in Neuhausen schwer verletzt worden. Er war offenbar in ein Schlagloch geraten. ... Huifang grills QFFL dainkaolu Barbecue Herd Barbecue Hot Pot EIN Elektroherd Startseite Smokeless Gegrillter Fisch Pot Elektrische Grillplatte 48 31 7cm

Unbekannt WL Camping Klappstuhl faltbar (Alu) - oliv
Mühlacker

Nach Weindorf-Besuch: 18-Jähriger wird von Unbekannten verprügelt

Vaihingen an der Enz. Ein 18-Jähriger ist am Sonntagabend nach einem Weindorf-Besuch in Vaihingen/Enz von drei Unbekannten verprügelt worden. Nun sucht die Polizei dringend Zeugen. ... mehr

Zyyaxky Hängematte Doppel Paar Hängematte Outdoor Travel Camping Hängematte Park Freizeit Schaukel Hängematte
MLX Leichter Kampierender Stuhl, Fischen-Stuhl, Der Tragbaren Einfachen Zug-Schlafsaal-Ausgangsbank Faltet
BlenderBottle Sportmixer Tritan Protein + Fitness Shaker mit BlenderBall

Wiernsheim. So stellt man sich einen gemütlichen Wahlsonntag vor: Zuerst wurden in Wiernsheim die Kreuzchen gemacht und dann gab es Speis und Trank und jede Menge Unterhaltung für die Kinder. ... mehr

XXHDYR Schaukelstuhl Liegestuhl Balkon Liegesessel Erwachsenen Klappstuhl Klappstuhl (Farbe : A)
KILLYSUFUY Tragbare Outdoor Gasheizung Camping Reise Butanheizung Multifunktionale Keramikbrenner Gasherd für Camping Klettern Angeln Heizung Öfen
Gino Gelati 6 Liter 2 in 1 Mini Kühlschrank Kühlbox Warmhaltebox Campingkühlschrank 12 & 220 Volt, kühlt bis 25°C unter Umgebungstemperatur

Pforzheim. Es gibt den alten Spruch, dass Prognosen und Vorhersagen schwierig sind, vor allem, wenn sie die Zukunft betreffen. Eine Prognose für die Veranstaltung „Nacht der Emotionen“ in Pforzheim abzugeben, fällt dennoch leicht. Wenn die Veranstaltung am 3. Dezember in der Goldstadt ihre vierte Auflage erlebt, wird die Bertha-Benz-Halle wieder ausverkauft sein. ... Tersol PVC-Blitz Geruchsneutraler Schnellgrundreiniger, 1 x 10 Liter Kanister

Sport regional
L&AIR FRYER Bratpfanne Große Kapazität Pommes Frites Elektrische Bratpfanne Öl Frei Intelligente Automatische Friteuse Luft Herd-4OZ / SCHWARZ

Pforzheim. Nachdem die Saison für den Fußball-Oberligisten 1. CfR Pforzheim beendet ist, bastelt die Sportliche Leitung weiter am Kader für die neue Saison. Wie Sportvorstand Torsten Heinemann am Montag mitteilte, wurden mit Nico Plattek und Lucas Turci zwei weitere Mittelfeldspieler verpflichtet. ... mehr

Astage Kühlbox FORESTIERE Crew 13 [W über 38,1 D über 25,8 H ca. 27,1 cm]
FYCZ Isolierung Topf, 2L Haushalt 304 Edelstahl 360 Grad Anti-invertiert Sealing Kettle Pot Auto Thermos
Dall hängematte Hängematten Doppelt Camping Hängematte Leichtgewicht Tragbar Wandern Reise Yard (Farbe : T01)
Y-YT Reise Camping Hängematte Wohnheim Camping Leinwand Anti-Rollover Erwachsenen Hängematte 200 80 cm

Pforzheim. Wer hätte das gedacht? Am letzten Spieltag der Fußball-Landesliga Mittelbaden geht es im Tabellenkeller noch einmal richtig rund. Vor allem dann, wenn die TSG Niefern am Dienstag (19.30 Uhr) das fällige Nachholspiel zuhause gegen den ATSV Mutschelbach II gewinnen sollte. ... JBHURF Große Kapazität 80L Outdoor-Bergsteigen Tasche professionelles Tragesystem Gelb (Farbe : Gelb)

6 Zoll / 8 Zoll / 10 Zoll Schwarze westliche Platte/Flacher Teller/Ausgangsteigwarenplatte/keramische runde Nachmittagsteekuchenplatte/Pizzateller (Farbe : 1, größe : 10 inches)
WMQQ Gürteltasche Männer Herren Taschen Handy Kamera Outdoor 8 Zoll Schulter Kreuz Brust Tasche Taille Tasche Gelb

Karlsruhe. Aufsteiger Karlsruher SC hat den Außenverteidiger Dirk Carlson als ersten Spieler für die kommende Saison in der 2. Fußball-Bundesliga verpflichtet. ... LÖFFLER He. Träger-Tights WS Softshell Warm

ZY Wottle Edelstahl Wiederaufladbare Handwärmer Becher Kreative Elektrische Heizung Schatz Student Cup Hochwertige Handwärmer
JJY Dreifache Bett Vierbeinigen Erweiterung Verstärkung Klappbett Einzigen Klappstuhl Mittagspause Sessel Outdoor Stahlrohr Escort,Navy
Bottleguard TPU Flasche Sleeve Displayschutzfolie für Hydro Fläschchen Fifty/Fifty & Takeya thermoflask Edelstahl Flaschen

Pforzheim. In der 1. Faustball-Bundesliga der Damen kam es in Calw zum Duell des Spitzenteams TSV Calw und TSV Dennach. Dabei gerieten die „pink ladies“ aus Dennach nach dem Verlust der ersten beiden Sätze in Rückstand. ... DIAOHXY Heavy Baumwolle Zweipersonen-Hängematte,Camping Hängematte Atmungsaktive Indoor Garten Dekoration Hängematte-A 240x160cm(94x63inch)

Version Des Trends Der Weichen Leder-Umhängetasche Große Handtasche Messenger Bag Weibliche Paket , hellgrau
Thetford Porta Potti Excellence Campingtoilette 21 Ltr Tank 44 cm Sitzhöhe mit Aquasoft

Spannende Bayern-Tage - Sané wäre «toll»

München (dpa) - Beim FC Bayern bleibt es spannend. Nach der beendeten Debatte um den neuen Double-Trainer Niko Kovac treiben die Münchner nun den Umbau ihres Fußball-Starensembles voran, damit es künftig auch in der Champions League wieder mehr zu jubeln gibt. ... mehr

LF&F Neue beiläufige Art und Weisedamebeutel modische Handtasche Schulterbeutel diagonales Querpaket Multifunktions im Freien Geschäft Datierung Einkaufen Berufsbürobeutel inneres Paket entfernbar
Sport weltweit

«Dickes Fell» - VfB hofft auf Rettung im Rückspiel bei Union

Berlin (dpa) - Der 1. FC Union Berlin hofft auf den ersten Bundesliga-Aufstieg seiner Clubgeschichte, der VfB will den dritten Abstieg in die 2. Bundesliga nach 1975 und 2016 verhindern. ... Protos Integral Forest - Forsthelm (blau/Neongelb) F39

Magazin
ROGUE NORTH AFRICA BAG BUFFALO LEATHER RTG-3B

Er brauche nur 24 Stunden, um alles in Ordnung zu bringen, sagt Mikesch (Andreas Lust) und rennt vor seinem Jugendkumpel und Kriminalhauptkommissar Franz Leitmayr (Udo Wachtveitl) davon. Doch man ahnt es schon: Was der nach einem Messerstich schwer verletzt aus dem Krankenhaus geflüchtete Mikesch seit Mitte der 80er-Jahre nicht auf die Reihe bekommen hat, wird er bis zum Ende des Münchner „Tatort: die ewige Welle“ nicht mehr schaffen. Der von einer unerreichbaren Zukunft fabulierende Tagträumer wird von der harten Realität eingeholt, während Leitmayr plötzlich seiner vergessenen Vergangenheit leibhaftig gegenübersteht. ... RFVBNM Camping Hängematte Farbe gestreifte Outdoor Doppel Hängematte Freizeit Reise tragbare Nylon Hängematte

Grünlans Edelstahl-Tee-Kaffeebecher mit tragbar, Camping Tasse
Baden-Württemberg
KFHSNJ Outdoor Beach Stuhl,Falten Geräumige Stuhl Mittagessen Pause Stuhl Für Wanderer, Camp, Beach, Angeln-Blau
SryWj 45L Auto Kühlschrank Auto Mit Mini Tragbare Große Kapazität Auto Kalt und Warm Box Fishing Gear Special

Erste vorläufige Ergebnisse von Gemeinderatswahlen in mehreren großen Städten Baden-Württembergs haben am Montag den Wahlsieg der Grünen und damit die Prognosen vom Wahlabend bestätigt. ... YUNJIE Professionelle Multifunktions Militär Armee Metall Sichtung Kompass,Wasserdicht und Rüttelfest Hohe Genauigkeit Outdoor Camping Wandern Militärische Nutzung Geschenke

Faith Mistress L Chair (Karpfenstuhl)
Baden-Württemberg
Therm-a-Rest quadra Chair faltstuhl faltstuhl

Karlsruhe/Speyer. Der Kampf gegen Stechmücken am Rhein hat einen empfindlichen Dämpfer bekommen. Nachdem am Sonntag ein Hubschrauber der Kommunalen Aktionsgemeinschaft zur Bekämpfung der Schnakenplage (Kabs) ausbrannte und auch der zweite defekt ist, könnten maximal 50 Prozent der Schnakenpopulation abgetötet werden, sagte am Montag Kabs-Sprecher Norbert Becker. ... mehr

Abbey Klappstuhl faltbar für Camping/Strand 53 x 57 x 65 cm
Extreme Pak Kühltasche W/JX Swamper Camo
Brunner Küche Küchenschrank Kocherschrank Waschbox Kombi Jum Box CTS Grau

Karlsruhe. Die europaweit erste Altersresidenz für Asiatische Elefanten ist fertig - der Karlsruher Zoo eröffnete am Montag eine neue Außenanlage für die Dickhäuter. Sie soll alten Elefantendamen aus Zoos und ausgedienten Zirkuselefanten als Bleibe dienen. ... Pelican Small Wire Basket Cooler, 35/45/65-Quart

Dey-Outdoor Camping Strand Portable Casual Multifunktionale Aluminiumlegierung Camouflage Klappstuhl
OUTAD S300 Indoor Cycling Bike mit 15 kg Schwungrad. Heimtrainer Fitness-Bike Cardio-Bike Fahrrad-Trainer mit Aluminium Trinkflasche. max bis 200 kg belastbar
Baden-Württemberg
F & H FH Outdoor Klappstuhl Direktor Stuhl Strand Stuhl Angeln Stuhl Freizeit Tragbaren Hausgarten Tisch Und Stuhl

Bruchsal. Ein betrunkener 21-Jähriger Deutscher wehrte sich am frühen Sonntagmorgen gegen seine Festnahme, nachdem er wegen einer Schlägerei aus einer Diskothek in der John-Deere-Straße geflogen war. ... mehr

Licy Auto Kühlschrank 15L Mini Kühlschrank Kühlung Heizung Student Büro 12v / 220 v Feld Speisen Outdoor Sports
Campingaz Icetime Plus Extreme Kühlbox

Lkw-Fahrer wechselt plötzlich von A8 auf A5: Crash mit mehreren Zehntausend Euro Schaden

Karlsruhe. Ein Lkw-Fahrer hat am Montagmorgen am Autobahndreieck Karlsruhe am Abzweig zwischen der A8 und der A5 plötzlich die Spur gewechselt und damit einen heftigen Unfall mit drei leichtverletzten Personen und einem Sachschaden in Höhe von mehreren Zehntausend Euro verursacht. ... BDFA Wasser-Behälter 2.5 Gallone / 4 Gallone / 5 Gallone / 6 Gallone, BPA-Freies Ungiftiges Pet, Eimer PE/Im Freien Trinkwasser-Behälter-Reservoir-Kampierender Behälter-Nahrungsmittelgrad

Rivalry NCAA Oregon State Beavers Kühltasche
Brennpunkte
Heavy Duty Klappliege Mit Kissen Und Kissen Erwachsenen Outdoor Camping Terrasse Rasen Widen Stühle, Metall
Männer Retro-beiläufige Segeltuchtasche mit Lederaktentasche tragbarer Schulter Messenger Bag

Berlin (dpa) - Nach den jüngsten Wahl-Desastern für die SPD will sich Partei- und Fraktionschefin Andrea Nahles in der Fraktion vorzeitig zur Neuwahl stellen. ... DOGYEARDAJI Outdoor Wasserdichte Faltbare Grasmatten Park Portable Teppich

ARecda 450 Edelstahl-Vakuum-Insulaterd-Flasche mit Ledergriff (Farbe : Weiß)
Brennpunkte

Ist die AfD die neue Ost-Partei?

Berlin/Dresden (dpa) - Die Grafik der AfD-Ergebnisse bei der Europawahl sieht aus wie eine alte Karte von BRD und DDR. Im Osten ohne Berlin - tiefblau - hat die Partei der Rechtspopulisten rund 20 Prozent geholt. Im Westen liegt sie fast überall im einstelligen Bereich. ... WLHW Trinkflaschen Hauptdämpfungs-Becher-Flaschentopf, 2L Auto-große Kapazitäts-im Freien Reise-Edelstahl

Colofar Im Freien kampierender Hängemattenschlafsaalparkschwingen Zwei Mann-Hängematte, die zusammenpassende Farbe Reißt
Brennpunkte
SeaEsta Lux Air Liege mit Tragetasche

Lyon (dpa) - Knapp drei Tage nach einer Explosion mit 13 Verletzten im französischen Lyon hat die Polizei mehrere Verdächtige festgenommen. Unter ihnen sei auch der mutmaßliche Täter, teilte die Staatsanwaltschaft mit. ... Mutter Eimer Tasche Schulter Messenger Handtasche Weibliche Paket Krokodil Muster Mutter Paket , Armeegrün

Lamzac Original Air Liege das stvoby2110-Stühle

Brennpunkte
LF&F Elegant Art und Weise Retro- scheuern Handtasche Schulterbeutel diagonales Paket beiläufiger Beutel im Freienspielraumbeutel Arbeit Spiel Geschäft beweglich

Wuppertal (dpa) - Die nächtlichen Umtriebe der selbst ernannten «Scharia-Polizei» in Wuppertal sind von der Justiz doch noch bestraft worden. ... BJL Mosquito Net Moskitonetz Moskitonetz Typ Court Princess Wind u-Guide Drei Tür Edelstahl Stark 1,5 m/1,8 m Home